PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G46130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 1267aa    MW: 140786 Da    PI: 7.7124
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G46130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.3e-1811681223257
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox    2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57  
                       rk+ ++++eql++Le+++e  ++++++ ++ LA+kl+++ rqV vWFqNrRa+ k+
  OGLUM01G46130.1 1168 RKKLRLSEEQLTVLENMYEAGSNLDQALKQGLAEKLNIKPRQVEVWFQNRRARTKH 1223
                       677889***********************************************995 PP

2HD-ZIP_I/II93.62.1e-3011681252185
      HD-ZIP_I/II    1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85  
                       +kk+rls+eq+++LE+++e+ ++L++  K+ la++L+++prqv+vWFqnrRARtk kq+E++++ Lkr+++ l++en+rL+ e  
  OGLUM01G46130.1 1168 RKKLRLSEEQLTVLENMYEAGSNLDQALKQGLAEKLNIKPRQVEVWFQNRRARTKHKQIEEECKNLKRWLEGLNKENRRLKMELM 1252
                       69*******************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR02468011091IPR012819Sucrose phosphate synthase, plant
CDDcd038007.79E-162211700No hitNo description
PfamPF008628.4E-13212475IPR000368Sucrose synthase
SuperFamilySSF537562.83E-67226700No hitNo description
Gene3DG3DSA:3.40.50.20006.0E-19514684No hitNo description
PfamPF005342.1E-23514682IPR001296Glycosyl transferase, family 1
PfamPF051162.5E-168471047IPR006380Sucrose-phosphatase, N-terminal
SuperFamilySSF466895.01E-1611581225IPR009057Homeodomain-like
PROSITE profilePS5007115.88811641224IPR001356Homeobox domain
SMARTSM003891.3E-1411661228IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1511681222IPR009057Homeodomain-like
PfamPF000463.1E-1511681223IPR001356Homeobox domain
CDDcd000863.71E-1411681225No hitNo description
PROSITE patternPS00027011991222IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005985Biological Processsucrose metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005794Cellular ComponentGolgi apparatus
GO:0016157Molecular Functionsucrose synthase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046524Molecular Functionsucrose-phosphate synthase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1267 aa     Download sequence    Send to blast
MAGNEWINGY LEAILDSGGA AGGGGGGGGG GGGGGGGGGG GGGGGGDPRS PAAGAASPRG  60
PHMNFNPTHY FVEEVVKGVD ESDLHRTWIK VVATRNARER STRLENMCWR IWHLARKKKQ  120
ACIDLSLSFS FFLVFMLELE GILRISARRK EQEQVRRETS EDLAEDLFEG EKADTVGELA  180
QQDTPMKKKF QRNFSELTVS WSDENKEKKL YIVLISLHGL VRGDNMELGR DSDTGGQVKY  240
VVELARALAT MPGVYRVDLF TRQVSSPEVD WSYGEPTEML TSGSTDGEGS GESAGAYIVR  300
IPCGPRDKYL RKEALWPYLQ EFVDGALAHI LNMSKALGEQ VSNGKVVLPY VIHGHYADAG  360
DVAALLSGAL NVPMVLTGHS LGRNKLEQIM KQGRMSKEEI DSTYKIMRRI EGEELALDAA  420
ELVITSTRQE IDEQWGLYDG FDVKLEKVLR ARARRGVSCH GRFMPRMVVI PPGMDFSSVV  480
VPEDTSDGDD GKDFEIASPR SLPPIWAEVM RFLTNPHKPM ILALSRPDPK KNITTLVKAF  540
GECRPLRELA NLILIMGNRD DIDEMSAGNA SVLTTVLKLI DKYDLYGSVA FPKHHKQSDV  600
PEIYRLTGKM KGVFINPALV EPFGLTLIEA AAHGLPIVAT KNGGPALNNG LLVDPHDQHA  660
IADALLKLVA DKNLWQECRK NGLRNIQLYS WPEHCRTYLT RIAGCRIRNP RWLMDTPADA  720
AAEEEALEDS LMDVQDLSLR LSIDGERGSS MNDAPSSDPQ DSVQRIMNKI KRSSPADTDG  780
AKIPAEAAAT ATATATSGAM NKYPLLRRRR RLFVIAVDCY GDDGSASKRM LQVIQEVFRA  840
VRSDSQMSRI SGFALSTAMP LPETLKLLQL GKIPPTDFDA LICGSGSEVY YPGTAQCVDA  900
GGRLRPDQDY LLHINHRWSH DGAKQTIAKL AHDGSGTNVE PDVESCNPHC VSFFIKDPNK  960
VRTIDEMRER MRMRGLRCHL MYCRNATRLQ VVPLLASRSQ ALRYLFVRWG LSVGNMYLIV  1020
GEHGDTDHEE MLSGLHKTVI IRGVTEKGSE QLVRSSGSYQ REDVVPSESP LIAFTKGDLK  1080
ADEIMRALKE VTKAASGMDW QRPLCKTAYW FQSRVYTNME EKEEMTMLSL GVGAASKHSI  1140
SNRKFRLKEV TDHKFNLGDQ DHNSGHVRKK LRLSEEQLTV LENMYEAGSN LDQALKQGLA  1200
EKLNIKPRQV EVWFQNRRAR TKHKQIEEEC KNLKRWLEGL NKENRRLKME LMRNAQKDCI  1260
KKGIQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2r60_A2e-5023370231456Glycosyl transferase, group 1
2r66_A2e-5023370231456Glycosyl transferase, group 1
2r68_A2e-5023370231456Glycosyl transferase, group 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1805811LRRRRRL
212161224RRARTKHKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1213410.0AK121341.1 Oryza sativa Japonica Group cDNA clone:J023120M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621705.10.0PREDICTED: probable sucrose-phosphate synthase 1
RefseqXP_015621706.10.0PREDICTED: probable sucrose-phosphate synthase 1
SwissprotQ0JGK40.0SPSA1_ORYSJ; Probable sucrose-phosphate synthase 1
SwissprotA2WYE90.0SPSA1_ORYSI; Probable sucrose-phosphate synthase 1
TrEMBLA0A0D9YJ890.0A0A0D9YJ89_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000239-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-25homeobox from Arabidopsis thaliana